PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn296511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 303aa    MW: 33665.8 Da    PI: 10.8726
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn296511genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14.1e-082062431047
                      HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       l++ + k +G+g+W++I+r +  +Rt+ q+ s+ qky
       Achn296511 206 RLFLIGLKTYGKGDWRSISRNVVVTRTPTQVASHAQKY 243
                      67888999*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.4E-9205249IPR009057Homeodomain-like
CDDcd001673.78E-5205243No hitNo description
TIGRFAMsTIGR015571.5E-9205247IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.6E-5205242IPR009057Homeodomain-like
PfamPF002494.8E-6205243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MIWKTQLGFE KNIKWGSSSR SLSSSSYSLN RGERGGEGPW AAFVERENLE GKREITQYEI  60
FDCLNSKFNY VWRRRQRLSV VDDRQLLGDS VGVDEVRGQG VRARASGVPG GNGRPVGEDR  120
RSTAGKVGRG GEGPLRSPGR RRARDRLGPS RAAELLGRVR AGLGGRVDPD LVFQEQARRG  180
REEEGDSLDS GRTQLGMLIP FGICDRLFLI GLKTYGKGDW RSISRNVVVT RTPTQVASHA  240
QKYHLRQDSV KKDRKRSSIH DITTTADTLP IPPPADFPNQ GGSMDRQQSK TKSAYYDIKH  300
LN*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-33MYB family protein